(data stored in ACNUC7421 zone)

EMBL: CP001053.PE87

CP001053.PE87        Location/Qualifiers
FT   CDS             111631..112569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4078"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0530 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4078"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18462"
FT                   /db_xref="GOA:B2TEE1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE1"
FT                   /protein_id="ACD18462.1"
FT                   /translation="MSDILDGVTTFVRVVETGSFALAAERMNLTRSAVGKVIVRLEKRL
FT                   GVRLLNRTTRSQSLTEDGQAYYDRCVRALAELEAAEADLDSGRREPQGRLRVSVPQAFG
FT                   HYCVAPVLLGLARKHPQLKIDISITDRFVDVIEEGFDLVVRVGPLADSVSLAARKLGMQ
FT                   HASIGAAPAYLARHGTPRNVEELRGHAVIGYLRAGSAQPWDVVDVDGQIRRAQVQPQLG
FT                   FDDMKGIVDAALAGFGLAWLPSWLLTRYEKTGELVTVMENCFRPAQEIHLVWPKSRYLA
FT                   LKTRCAIDALVAEIPAMIGAPAPGAPRSRDA"
     MSDILDGVTT FVRVVETGSF ALAAERMNLT RSAVGKVIVR LEKRLGVRLL NRTTRSQSLT        60
     EDGQAYYDRC VRALAELEAA EADLDSGRRE PQGRLRVSVP QAFGHYCVAP VLLGLARKHP       120
     QLKIDISITD RFVDVIEEGF DLVVRVGPLA DSVSLAARKL GMQHASIGAA PAYLARHGTP       180
     RNVEELRGHA VIGYLRAGSA QPWDVVDVDG QIRRAQVQPQ LGFDDMKGIV DAALAGFGLA       240
     WLPSWLLTRY EKTGELVTVM ENCFRPAQEI HLVWPKSRYL ALKTRCAIDA LVAEIPAMIG       300
     APAPGAPRSR DA                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page