(data stored in ACNUC7421 zone)

EMBL: CP001053.PE88

CP001053.PE88        Location/Qualifiers
FT   CDS             complement(112566..114749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4079"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bxe:Bxe_B0531 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4079"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18463"
FT                   /db_xref="GOA:B2TEE2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE2"
FT                   /protein_id="ACD18463.1"
FT                   /translation="MQKFFVAGRPAFVRGPRRTPSLLSAGLLASVGLTLSTLSTSGWAQ
FT                   VAASDAGTTLPAVSVSAAKDTTVAQADTISAGALGSRKQVDTPFSTHVVTSDEAQDLFA
FT                   TTANDLYKYDPAVSVISDNGVSENSMFTVRGMPIDTLNSVKVDGQTFPSWDTDLSLEPF
FT                   EQVELLKGLSGFMYGFGSPGGIVNYVLKRPTDTPYRSISVGYKSAGVFSEAVDLGGRFG
FT                   NDDRFGYRLNLANENGNTAEDHGHVRRQVASLAFDFRITPDLTWSADAFYQKRRTNGTL
FT                   FGLMFGGDAGGIPDASKVTHALTQPQNYYETEMASFGTGLDYRISENWHASIKYRFAKE
FT                   NRTNSDSFLFVTDPAGNYSNTLYAALTRYFYQNVDGMVQGHFNTGTIKHDVVVGAGFLT
FT                   QTSEYSNSTGWNEGYFLGNGNLYASTLLTNDEVSISSNLYRQQRTTQAAVYASDTVQLT
FT                   SRLAALVGVRYTQYQQHVYDPSGAVSSQYQADPVTPTFALMFKTDPYSTLYVSYVESLE
FT                   QGGAASNTNLNYPDTFGPLRSKQYEVGFKTDHAKWGANLALFRVDQGYNYTNVDNIFVQ
FT                   DGTKRYQGLDASGWLAVTSEWRVLGGVMWLDTKAMDVNDPTVEGKRIYGAPRFTVTGRI
FT                   EYNPSYLRPLTLAFGGKYVGNQAVDAQNTQFVPAYTTFDLSGRYETKIAGKDVTFRAGI
FT                   NNLFNRRYWTTAWGYYVAPSATRTAVASATLQF"
     MQKFFVAGRP AFVRGPRRTP SLLSAGLLAS VGLTLSTLST SGWAQVAASD AGTTLPAVSV        60
     SAAKDTTVAQ ADTISAGALG SRKQVDTPFS THVVTSDEAQ DLFATTANDL YKYDPAVSVI       120
     SDNGVSENSM FTVRGMPIDT LNSVKVDGQT FPSWDTDLSL EPFEQVELLK GLSGFMYGFG       180
     SPGGIVNYVL KRPTDTPYRS ISVGYKSAGV FSEAVDLGGR FGNDDRFGYR LNLANENGNT       240
     AEDHGHVRRQ VASLAFDFRI TPDLTWSADA FYQKRRTNGT LFGLMFGGDA GGIPDASKVT       300
     HALTQPQNYY ETEMASFGTG LDYRISENWH ASIKYRFAKE NRTNSDSFLF VTDPAGNYSN       360
     TLYAALTRYF YQNVDGMVQG HFNTGTIKHD VVVGAGFLTQ TSEYSNSTGW NEGYFLGNGN       420
     LYASTLLTND EVSISSNLYR QQRTTQAAVY ASDTVQLTSR LAALVGVRYT QYQQHVYDPS       480
     GAVSSQYQAD PVTPTFALMF KTDPYSTLYV SYVESLEQGG AASNTNLNYP DTFGPLRSKQ       540
     YEVGFKTDHA KWGANLALFR VDQGYNYTNV DNIFVQDGTK RYQGLDASGW LAVTSEWRVL       600
     GGVMWLDTKA MDVNDPTVEG KRIYGAPRFT VTGRIEYNPS YLRPLTLAFG GKYVGNQAVD       660
     AQNTQFVPAY TTFDLSGRYE TKIAGKDVTF RAGINNLFNR RYWTTAWGYY VAPSATRTAV       720
     ASATLQF                                                                 727
//

If you have problems or comments...

PBIL Back to PBIL home page