(data stored in ACNUC7421 zone)

EMBL: CP001053.PE90

CP001053.PE90        Location/Qualifiers
FT   CDS             complement(117501..117731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4081"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18465"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE4"
FT                   /protein_id="ACD18465.1"
FT                   /translation="MKGFRFGSNQGAFYILPGQDGWEATYGNETLGEFASPQQAADDLA
FT                   RGLICPHLSEGDDTSTLEIPEKLSEWEIVHV"
     MKGFRFGSNQ GAFYILPGQD GWEATYGNET LGEFASPQQA ADDLARGLIC PHLSEGDDTS        60
     TLEIPEKLSE WEIVHV                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page