(data stored in ACNUC7421 zone)

EMBL: CP001053.PE93

CP001053.PE93        Location/Qualifiers
FT   CDS             complement(120657..122909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4084"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; ATP-grasp domain
FT                   protein; KEGG: bpt:Bpet2987 acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4084"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18468"
FT                   /db_xref="GOA:B2TEE7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE7"
FT                   /protein_id="ACD18468.1"
FT                   /translation="MNPATHDAGALDIGRLVEPRSIAIIGASNDPKSISGQPMRFLMQH
FT                   GYQGTLYPVNPKYAQIDGVACHDSIAALPSTPDLALILVAARRVPDMLRQCGEKGVGFA
FT                   IVYSSGFAEAGEAGAALQRECADIAKAHGIRVIGPNCQGFVSTGANVYAGFGAPFGVAY
FT                   RRGGLSLISQSGGFGCALLLMADELGIGLRHFITTGNEADVSLLDLVNACIADPHTSLI
FT                   ATYIEGLKDAGRLVDMANRALDAGKPLLAWKVGNTADGAKAAASHTANLGGASALYRTA
FT                   FRQTGVIEVSDVADLGDYARAFEAGRLPRGKRIAVVTLSGGAGILITDACAERGMSVPA
FT                   LSAATLERLKPIVPAFASLNNPIDLTAGILAEPKIFADALQIIADDPNIDAIAIMAAAA
FT                   SGEVAQAMATAIVRVYGSIDKPLMLAWNARRDMAGEAYETIEAHGVPLYATPVRCGRAF
FT                   AALADYAQARRARAEARDPMPRALRRYDVEHARALLVDIQGKHGDLDLTEHASQALLRD
FT                   YGIDVPKSGLAQNRDQACALARAIGFPLVIKVQSPDIAHKTEAGAVRVGIRDEATLAAA
FT                   FDEIVGNAHRHVPHARIEGVLVQEEIRDALEMIVGIENDASFGPAVMCGLGGIYAEVLK
FT                   DVSFRLAPVTHADAHAMIRELRSFAMLDGARGKPPGDIEALVETIVALSTMALDQRASL
FT                   RELDINPLFVLPAGKGVRAGDALARLLPRAADSNDAADRTGAMHESEHCAPAVVDG"
     MNPATHDAGA LDIGRLVEPR SIAIIGASND PKSISGQPMR FLMQHGYQGT LYPVNPKYAQ        60
     IDGVACHDSI AALPSTPDLA LILVAARRVP DMLRQCGEKG VGFAIVYSSG FAEAGEAGAA       120
     LQRECADIAK AHGIRVIGPN CQGFVSTGAN VYAGFGAPFG VAYRRGGLSL ISQSGGFGCA       180
     LLLMADELGI GLRHFITTGN EADVSLLDLV NACIADPHTS LIATYIEGLK DAGRLVDMAN       240
     RALDAGKPLL AWKVGNTADG AKAAASHTAN LGGASALYRT AFRQTGVIEV SDVADLGDYA       300
     RAFEAGRLPR GKRIAVVTLS GGAGILITDA CAERGMSVPA LSAATLERLK PIVPAFASLN       360
     NPIDLTAGIL AEPKIFADAL QIIADDPNID AIAIMAAAAS GEVAQAMATA IVRVYGSIDK       420
     PLMLAWNARR DMAGEAYETI EAHGVPLYAT PVRCGRAFAA LADYAQARRA RAEARDPMPR       480
     ALRRYDVEHA RALLVDIQGK HGDLDLTEHA SQALLRDYGI DVPKSGLAQN RDQACALARA       540
     IGFPLVIKVQ SPDIAHKTEA GAVRVGIRDE ATLAAAFDEI VGNAHRHVPH ARIEGVLVQE       600
     EIRDALEMIV GIENDASFGP AVMCGLGGIY AEVLKDVSFR LAPVTHADAH AMIRELRSFA       660
     MLDGARGKPP GDIEALVETI VALSTMALDQ RASLRELDIN PLFVLPAGKG VRAGDALARL       720
     LPRAADSNDA ADRTGAMHES EHCAPAVVDG                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page