(data stored in ACNUC7421 zone)

EMBL: CP001053.PE94

CP001053.PE94        Location/Qualifiers
FT   CDS             complement(122918..124114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4085"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: rme:Rmet_1816
FT                   acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4085"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18469"
FT                   /db_xref="GOA:B2TEE8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEE8"
FT                   /protein_id="ACD18469.1"
FT                   /translation="MTSHSSHFDAMLAGVAKFVRDEAIPRENEIEQADAVPADLVQRMR
FT                   ELGYFGWSIPRDFGGAGLSTEQLVRGAFELSQASVAFRARVGTNTGIGSEALVADGTDT
FT                   QKQRYLPRLASGEFTGAFALTEPDAGSDATALRTTARRDGDHYILDGSKCFITNAPIAD
FT                   LFTVMARTELAKPGAGGISAFLVERGTPGLSTSAPYDKMGQAGSPVGDVVFEGCRVPAA
FT                   NLIGGKEGMGFRTAMKVLNKQRIHLAALCTGPAMRMLEEAVAYTSRREQFGKPVAEFQL
FT                   VQALIAECQTEIYAARSMILETARKRDAGEDVALEASMCKMFASEMCGRVADRAVQMLG
FT                   GRGYLAGNAVERFYRDVRAFRIYEGTTQIHQLNIAKITLRRAAERDQAKVRADAACAA"
     MTSHSSHFDA MLAGVAKFVR DEAIPRENEI EQADAVPADL VQRMRELGYF GWSIPRDFGG        60
     AGLSTEQLVR GAFELSQASV AFRARVGTNT GIGSEALVAD GTDTQKQRYL PRLASGEFTG       120
     AFALTEPDAG SDATALRTTA RRDGDHYILD GSKCFITNAP IADLFTVMAR TELAKPGAGG       180
     ISAFLVERGT PGLSTSAPYD KMGQAGSPVG DVVFEGCRVP AANLIGGKEG MGFRTAMKVL       240
     NKQRIHLAAL CTGPAMRMLE EAVAYTSRRE QFGKPVAEFQ LVQALIAECQ TEIYAARSMI       300
     LETARKRDAG EDVALEASMC KMFASEMCGR VADRAVQMLG GRGYLAGNAV ERFYRDVRAF       360
     RIYEGTTQIH QLNIAKITLR RAAERDQAKV RADAACAA                               398
//

If you have problems or comments...

PBIL Back to PBIL home page