(data stored in ACNUC7421 zone)

EMBL: CP001053.PE96

CP001053.PE96        Location/Qualifiers
FT   CDS             complement(125233..126573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4087"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18471"
FT                   /db_xref="InterPro:IPR021847"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF0"
FT                   /protein_id="ACD18471.1"
FT                   /translation="MRKIARIIAAALGLGLALGLAGCGGGGGGSSSNSTANAPANAPVA
FT                   ASAPAGPGGTMSNPSTGDSSSNTLAVDASAVPTPVGPGNTMSVTVSGTGIHNQPMVSVK
FT                   LCAPGSNASTSCTTIPNVIVDTASFGLRLVRSAIPTSTFNALTAETDQSSGLPLAECAL
FT                   FGSGYAWGSVHLADIGLSSEVAASVPIQVIGDSALTIAAPSECQVGRPLAAASDLGANG
FT                   ILGIGVSPVDCGSQCALTVLSQFYYTNAGNAVSVPVSKQISNPVARFAQDNNGVILEMA
FT                   QVSDSGSATAQGTLVFGIDTQANNVLNGTGAPIFRTDLNGDFTSSYGGTTFTQTFFDSG
FT                   STVMFFPDTTIPRDTSSGYYIPTATVGRTSTLIGTNPASVSLGFNIANGATLTSSGNNA
FT                   FNNLGIYMTRQFDFGLPFFYGRHVYYGISGRASSGGGTGPYVAYVSS"
     MRKIARIIAA ALGLGLALGL AGCGGGGGGS SSNSTANAPA NAPVAASAPA GPGGTMSNPS        60
     TGDSSSNTLA VDASAVPTPV GPGNTMSVTV SGTGIHNQPM VSVKLCAPGS NASTSCTTIP       120
     NVIVDTASFG LRLVRSAIPT STFNALTAET DQSSGLPLAE CALFGSGYAW GSVHLADIGL       180
     SSEVAASVPI QVIGDSALTI AAPSECQVGR PLAAASDLGA NGILGIGVSP VDCGSQCALT       240
     VLSQFYYTNA GNAVSVPVSK QISNPVARFA QDNNGVILEM AQVSDSGSAT AQGTLVFGID       300
     TQANNVLNGT GAPIFRTDLN GDFTSSYGGT TFTQTFFDSG STVMFFPDTT IPRDTSSGYY       360
     IPTATVGRTS TLIGTNPASV SLGFNIANGA TLTSSGNNAF NNLGIYMTRQ FDFGLPFFYG       420
     RHVYYGISGR ASSGGGTGPY VAYVSS                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page