(data stored in ACNUC7421 zone)

EMBL: CP001053.PE97

CP001053.PE97        Location/Qualifiers
FT   CDS             complement(126604..127098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4088"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18472"
FT                   /db_xref="InterPro:IPR021267"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF1"
FT                   /protein_id="ACD18472.1"
FT                   /translation="MLAVAAASLALVALAAPAYAALGAAPTYPVTASSTSAGAASQNSA
FT                   AVARFAASGSAASAAYTVSQTTLPSGTVVSEYIGAGNTVFALSWQGPTMPPLKTLLAAY
FT                   FPSYVQALTDAHATQGGGYGPAAVHQSALVVETGGHMGAFVGRAYLPQALPQGVSADDI
FT                   K"
     MLAVAAASLA LVALAAPAYA ALGAAPTYPV TASSTSAGAA SQNSAAVARF AASGSAASAA        60
     YTVSQTTLPS GTVVSEYIGA GNTVFALSWQ GPTMPPLKTL LAAYFPSYVQ ALTDAHATQG       120
     GGYGPAAVHQ SALVVETGGH MGAFVGRAYL PQALPQGVSA DDIK                        164
//

If you have problems or comments...

PBIL Back to PBIL home page