(data stored in ACNUC7421 zone)

EMBL: CP001069.PE1

CP001069.PE1         Location/Qualifiers
FT   CDS             complement(23..1618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3761"
FT                   /product="peptide chain release factor 3"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein; KEGG:
FT                   rso:RSp1662 peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3761"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28877"
FT                   /db_xref="GOA:B2UH26"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH26"
FT                   /protein_id="ACD28877.1"
FT                   /translation="MSTLQQEIRRRRTFAIIAHPDAGKTTLTEKLLWFGGAIQMAGAVR
FT                   ARKANRHATSDWMEMEKQRGISVTSSVMQFPYRNEGGDYIVNLLDTPGHEDFSEDTYRT
FT                   LTAVDSAVMVIDSVNGVEAQTIKLLNVCRLRSTPILTFINKLDREGRAPIELLDEIESV
FT                   LQIQCAPMTWPIGMGKSFKGVYHLVNDTVQLFDPNADSEKGATAGLIQGLDNPELDRVL
FT                   GSQAEELRIDIELVRGASHTFDKEAFLAGKQCPVYFGSAVNNFGVQSLLDALVDQSPEP
FT                   LARPTETREVKPMEEKFTGFVFKIQANMDPKHRDRIAFVRVCSGRFERGMKLLQVSTGK
FT                   TVAINNAITFMAQDRNTTEEAFAGDIIGVPNHGTIRLGDAFTEGEALKFTGIPSFAPEF
FT                   FRRARLNNPLRLKQLQKGLQQLAEEGATQMFRPLASNDLVLGAVGILQFDVVAHRLEHE
FT                   YGVDAIFEPHECSTARWLRGKQEDIDKLIDKAGHNVALDGAGDYVYLAPSQVNLRLTQE
FT                   RFPDIQFMETREIV"
     MSTLQQEIRR RRTFAIIAHP DAGKTTLTEK LLWFGGAIQM AGAVRARKAN RHATSDWMEM        60
     EKQRGISVTS SVMQFPYRNE GGDYIVNLLD TPGHEDFSED TYRTLTAVDS AVMVIDSVNG       120
     VEAQTIKLLN VCRLRSTPIL TFINKLDREG RAPIELLDEI ESVLQIQCAP MTWPIGMGKS       180
     FKGVYHLVND TVQLFDPNAD SEKGATAGLI QGLDNPELDR VLGSQAEELR IDIELVRGAS       240
     HTFDKEAFLA GKQCPVYFGS AVNNFGVQSL LDALVDQSPE PLARPTETRE VKPMEEKFTG       300
     FVFKIQANMD PKHRDRIAFV RVCSGRFERG MKLLQVSTGK TVAINNAITF MAQDRNTTEE       360
     AFAGDIIGVP NHGTIRLGDA FTEGEALKFT GIPSFAPEFF RRARLNNPLR LKQLQKGLQQ       420
     LAEEGATQMF RPLASNDLVL GAVGILQFDV VAHRLEHEYG VDAIFEPHEC STARWLRGKQ       480
     EDIDKLIDKA GHNVALDGAG DYVYLAPSQV NLRLTQERFP DIQFMETREI V                531
//

If you have problems or comments...

PBIL Back to PBIL home page