(data stored in SCRATCH zone)

EMBL: CP001069.PE101

CP001069.PE101       Location/Qualifiers
FT   CDS             116177..116872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3863"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: reu:Reut_B4062 metal-dependent phosphohydrolase, HD
FT                   subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3863"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28977"
FT                   /db_xref="GOA:B2UHC6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC6"
FT                   /protein_id="ACD28977.1"
FT                   /translation="MAQQSRPHIILASLTLAGGSRYPSALGHLVRTAAVAAYLANVLEL
FT                   DDAEQRHIYLVAPVHDIGKLGIPDDVLLKPAALTDAEHEIMQRHSNIGADLLAGTADPI
FT                   LQLAASVARHHHEHFDGSGYPAGLAGEDVPLAARIVAVADAFDAMLEPRVYREGMSEDD
FT                   AVGAVADQSGRYFDPTLVECFLKNVLGVRRARAAAESLVQQYGDVSGVIRFYGARDQSP
FT                   AFLRYIQTL"
     MAQQSRPHII LASLTLAGGS RYPSALGHLV RTAAVAAYLA NVLELDDAEQ RHIYLVAPVH        60
     DIGKLGIPDD VLLKPAALTD AEHEIMQRHS NIGADLLAGT ADPILQLAAS VARHHHEHFD       120
     GSGYPAGLAG EDVPLAARIV AVADAFDAML EPRVYREGMS EDDAVGAVAD QSGRYFDPTL       180
     VECFLKNVLG VRRARAAAES LVQQYGDVSG VIRFYGARDQ SPAFLRYIQT L                231
//

If you have problems or comments...

PBIL Back to PBIL home page