(data stored in ACNUC7421 zone)

EMBL: CP001069.PE108

CP001069.PE108       Location/Qualifiers
FT   CDS             124391..125287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3872"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein; SMART:
FT                   DEAD-like helicases; KEGG: ses:SARI_00228 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3872"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28984"
FT                   /db_xref="GOA:B2UHD3"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD3"
FT                   /protein_id="ACD28984.1"
FT                   /translation="MKTELPNEHGLSDGSLRHLLFYQDGKPSLSDIQHQGLVAGVARDT
FT                   SMLVVSPTSTGKTQLAVWAIAKGIENDCRTVYLVTHRALAKQKFDDFKSLFLSNFLSGN
FT                   PASLVLATGDSVEDSEGEFPPEPLKASLLVATYEKYLAMLSASGVPRDMSNTVVVCDEI
FT                   QLIGDKNRGQNVEILLTLLRNAGWRQFVGLSAVLPSRDAHDLADWLGVQLIMKATREKH
FT                   LSYRTAFSVTLCHPGVDPSVAPVVAACGRLCVVESVDLGEALLRYCEGSLSNDQLYRWL
FT                   ATPGQALAADLPFVERV"
     MKTELPNEHG LSDGSLRHLL FYQDGKPSLS DIQHQGLVAG VARDTSMLVV SPTSTGKTQL        60
     AVWAIAKGIE NDCRTVYLVT HRALAKQKFD DFKSLFLSNF LSGNPASLVL ATGDSVEDSE       120
     GEFPPEPLKA SLLVATYEKY LAMLSASGVP RDMSNTVVVC DEIQLIGDKN RGQNVEILLT       180
     LLRNAGWRQF VGLSAVLPSR DAHDLADWLG VQLIMKATRE KHLSYRTAFS VTLCHPGVDP       240
     SVAPVVAACG RLCVVESVDL GEALLRYCEG SLSNDQLYRW LATPGQALAA DLPFVERV         298
//

If you have problems or comments...

PBIL Back to PBIL home page