(data stored in ACNUC7421 zone)

EMBL: CP001069.PE111

CP001069.PE111       Location/Qualifiers
FT   CDS             127550..127828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3875"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc3434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3875"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28987"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHD6"
FT                   /protein_id="ACD28987.1"
FT                   /translation="MNVDDNLLYAQGALAAKEYLHKARMDMKMHRKFEPQTLRCHKQVY
FT                   VKDKALEFQAGFMDAIGAFILSSLDGVTVDLFRWDVLHVLARANKQK"
     MNVDDNLLYA QGALAAKEYL HKARMDMKMH RKFEPQTLRC HKQVYVKDKA LEFQAGFMDA        60
     IGAFILSSLD GVTVDLFRWD VLHVLARANK QK                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page