(data stored in SCRATCH zone)

EMBL: CP001069.PE117

CP001069.PE117       Location/Qualifiers
FT   CDS             complement(134874..135800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3883"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS02988 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3883"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28993"
FT                   /db_xref="GOA:B2UHE2"
FT                   /db_xref="InterPro:IPR033424"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHE2"
FT                   /protein_id="ACD28993.1"
FT                   /translation="MTETLDMQRGLLLNLSPGRRTYWMAQAVAILSLVVLVSAVPFAKV
FT                   QLAQLPSFVPIYESALILNDLITAALLFGQFAITRSRAMLALASGYLFTAATAVGHLLS
FT                   FPGLFASGGLLGAGPQSTAWIYMFWHTGFPLFVIAYAVLKSREEREPGRFPVHTLTRQT
FT                   ALATVAAVLGASIACVLLATVGDHLLPTIMAANRYTRTMGIVAGGTWCFCVAALVALWR
FT                   SRPHLTLDVWLMVVLCVWICDVALSAVFNGGRYDLGFYAGRMFGLLGASFVLLLLLIEN
FT                   TVLHSRLAAARAELKRLAASHVADGER"
     MTETLDMQRG LLLNLSPGRR TYWMAQAVAI LSLVVLVSAV PFAKVQLAQL PSFVPIYESA        60
     LILNDLITAA LLFGQFAITR SRAMLALASG YLFTAATAVG HLLSFPGLFA SGGLLGAGPQ       120
     STAWIYMFWH TGFPLFVIAY AVLKSREERE PGRFPVHTLT RQTALATVAA VLGASIACVL       180
     LATVGDHLLP TIMAANRYTR TMGIVAGGTW CFCVAALVAL WRSRPHLTLD VWLMVVLCVW       240
     ICDVALSAVF NGGRYDLGFY AGRMFGLLGA SFVLLLLLIE NTVLHSRLAA ARAELKRLAA       300
     SHVADGER                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page