(data stored in SCRATCH zone)

EMBL: CP001069.PE122

CP001069.PE122       Location/Qualifiers
FT   CDS             complement(139069..140004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3889"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_C6950 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3889"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28998"
FT                   /db_xref="GOA:B2UHE7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHE7"
FT                   /protein_id="ACD28998.1"
FT                   /translation="MAHRIAVLIFPDFQLLDAAGPVAAFEVASRYRDDHYALRTVAAQA
FT                   GLVRSSSGARWDADALPPASQVDTLLIAGGDGVDAAMADARTRRFVQRCAARGARVASV
FT                   CSGSLLLAATGLLNGRRATTHWSRSEQFARAFPQVQLEPDHIYVNDGPIWTSAGISAGI
FT                   DLALALIADDLGERLARAVARQLVVYYRRPGGQSQFSALNEMDSARGRFKPLLDHVRRN
FT                   LGAPHRVGDLAEHACMSPRHFARAFQVETGLTPAKAVEKLRVEAARAALESGAVSMQRV
FT                   ATECGFGDTERMRRSFQRLLGVPPSSLRAR"
     MAHRIAVLIF PDFQLLDAAG PVAAFEVASR YRDDHYALRT VAAQAGLVRS SSGARWDADA        60
     LPPASQVDTL LIAGGDGVDA AMADARTRRF VQRCAARGAR VASVCSGSLL LAATGLLNGR       120
     RATTHWSRSE QFARAFPQVQ LEPDHIYVND GPIWTSAGIS AGIDLALALI ADDLGERLAR       180
     AVARQLVVYY RRPGGQSQFS ALNEMDSARG RFKPLLDHVR RNLGAPHRVG DLAEHACMSP       240
     RHFARAFQVE TGLTPAKAVE KLRVEAARAA LESGAVSMQR VATECGFGDT ERMRRSFQRL       300
     LGVPPSSLRA R                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page