(data stored in ACNUC7421 zone)

EMBL: CP001069.PE126

CP001069.PE126       Location/Qualifiers
FT   CDS             142862..143722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3894"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3894"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29002"
FT                   /db_xref="GOA:B2UHF1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF1"
FT                   /protein_id="ACD29002.1"
FT                   /translation="MKNWLATIAGWTLCACAAFGNAAHAADAPDDGATLSVNIGTEHRT
FT                   LSRDALLHDPHLTSVTVEDQNLKHRLTFKAIPVTALFRGQTVSPEASATTAASDGYVSH
FT                   LPMRLLLGDRADGPRAWLAVEDPAAPWPTLKGQDIGPFRLIWTAPPAKASVVNESLWTY
FT                   SIVRIDIAALPGERFAAIRPAAGLPADGPVMRGFATFQRVCFSCHTLNRAGDANLGPDL
FT                   NVPYSPVEYLGDEKLRHLIRDPQSLRWWPNARMSAIDEKTLSDAQLNDLLAYFHHMTKR
FT                   KSAAQ"
     MKNWLATIAG WTLCACAAFG NAAHAADAPD DGATLSVNIG TEHRTLSRDA LLHDPHLTSV        60
     TVEDQNLKHR LTFKAIPVTA LFRGQTVSPE ASATTAASDG YVSHLPMRLL LGDRADGPRA       120
     WLAVEDPAAP WPTLKGQDIG PFRLIWTAPP AKASVVNESL WTYSIVRIDI AALPGERFAA       180
     IRPAAGLPAD GPVMRGFATF QRVCFSCHTL NRAGDANLGP DLNVPYSPVE YLGDEKLRHL       240
     IRDPQSLRWW PNARMSAIDE KTLSDAQLND LLAYFHHMTK RKSAAQ                      286
//

If you have problems or comments...

PBIL Back to PBIL home page