(data stored in SCRATCH zone)

EMBL: CP001069.PE127

CP001069.PE127       Location/Qualifiers
FT   CDS             complement(143739..144248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3895"
FT                   /product="protein of unknown function DUF1697"
FT                   /note="PFAM: protein of unknown function DUF1697; KEGG:
FT                   bja:bll4334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3895"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29003"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF2"
FT                   /protein_id="ACD29003.1"
FT                   /translation="MPSYIAFLRAVNVGGTGKLPMAELRAMCESIGLTGVRTYIASGNV
FT                   VFQSRLAETTVKAKLERCLEDYAGKPVGVLVRTGAELAAVLEGNPFKTAAPSRTVAIFL
FT                   DTPPPADALAAATGRRTEEMALGTREIYVHYGDGMADSKLKIPAAKTGTARNMNTIATL
FT                   VDWATE"
     MPSYIAFLRA VNVGGTGKLP MAELRAMCES IGLTGVRTYI ASGNVVFQSR LAETTVKAKL        60
     ERCLEDYAGK PVGVLVRTGA ELAAVLEGNP FKTAAPSRTV AIFLDTPPPA DALAAATGRR       120
     TEEMALGTRE IYVHYGDGMA DSKLKIPAAK TGTARNMNTI ATLVDWATE                   169
//

If you have problems or comments...

PBIL Back to PBIL home page