(data stored in ACNUC7421 zone)

EMBL: CP001069.PE13

CP001069.PE13        Location/Qualifiers
FT   CDS             complement(11811..12347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3773"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   eba:ebA6940 conserved hypothetical protein, predicted
FT                   phosphatidic acid-phosphatase related phosphoesterase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3773"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28889"
FT                   /db_xref="GOA:B2UH38"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH38"
FT                   /protein_id="ACD28889.1"
FT                   /translation="MATHVWPDWKRWRERDRRLAVALNNVAGDPSVMRFYRGVSRLGDG
FT                   MLWYALMAALPVVGGDTGWECAKQMGLTGLLSLVIYIVLKRGVCRPRPYLSCEEIHLCG
FT                   RVLDQFSFPSGHTLHAVSFSIVMAAYYPRMALALAPFTLMVALSRVILGLHYPSDVLAG
FT                   AGLGVLIGGLSVWLF"
     MATHVWPDWK RWRERDRRLA VALNNVAGDP SVMRFYRGVS RLGDGMLWYA LMAALPVVGG        60
     DTGWECAKQM GLTGLLSLVI YIVLKRGVCR PRPYLSCEEI HLCGRVLDQF SFPSGHTLHA       120
     VSFSIVMAAY YPRMALALAP FTLMVALSRV ILGLHYPSDV LAGAGLGVLI GGLSVWLF         178
//

If you have problems or comments...

PBIL Back to PBIL home page