(data stored in SCRATCH zone)

EMBL: CP001069.PE132

CP001069.PE132       Location/Qualifiers
FT   CDS             149036..149491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3900"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29008"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF7"
FT                   /protein_id="ACD29008.1"
FT                   /translation="MNIRSNVLVIRIVLLTVVSLIASLAATAALAAPPATVASCDGIKD
FT                   AYPILGTQCANHYAKINHAPATAAERRETYSARIAVLDIFRKALLCNGMYGASKPAQQR
FT                   FSSGEAGHLQALANLNAAMTIAGDPNVPVLYTASDLSDVSINKSQCK"
     MNIRSNVLVI RIVLLTVVSL IASLAATAAL AAPPATVASC DGIKDAYPIL GTQCANHYAK        60
     INHAPATAAE RRETYSARIA VLDIFRKALL CNGMYGASKP AQQRFSSGEA GHLQALANLN       120
     AAMTIAGDPN VPVLYTASDL SDVSINKSQC K                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page