(data stored in SCRATCH zone)

EMBL: CP001069.PE133

CP001069.PE133       Location/Qualifiers
FT   CDS             complement(149713..150606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3902"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bch:Bcen2424_3766 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3902"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29009"
FT                   /db_xref="GOA:B2UHF8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHF8"
FT                   /protein_id="ACD29009.1"
FT                   /translation="MNNLRRLDLNLLVTLDVLLTEHNVTRAAERLNFSQPSVSVHLAKL
FT                   RDIFGDPLLLPGPRGMRPTARAESLREPLRLALEALEQAVAPASPFDPAHATNTWRVAA
FT                   TDYGESTIALPVLNTLRTSAPGTRLAMLGLVPTRIEKQAEQGEIDLAFHTTDGAPPGLR
FT                   RRALFTERYVLIGRAGHPRLKRRPTLAQFCTLDHVIVSPDGGGFFGVTDEALAAAGATR
FT                   RVVLSVPHFLFVMTAVASTDMVAMLPERLVRGASALQAVEPPVEVPGYEMSMLWHERVH
FT                   RDPGHQWLRDVIAGAV"
     MNNLRRLDLN LLVTLDVLLT EHNVTRAAER LNFSQPSVSV HLAKLRDIFG DPLLLPGPRG        60
     MRPTARAESL REPLRLALEA LEQAVAPASP FDPAHATNTW RVAATDYGES TIALPVLNTL       120
     RTSAPGTRLA MLGLVPTRIE KQAEQGEIDL AFHTTDGAPP GLRRRALFTE RYVLIGRAGH       180
     PRLKRRPTLA QFCTLDHVIV SPDGGGFFGV TDEALAAAGA TRRVVLSVPH FLFVMTAVAS       240
     TDMVAMLPER LVRGASALQA VEPPVEVPGY EMSMLWHERV HRDPGHQWLR DVIAGAV          297
//

If you have problems or comments...

PBIL Back to PBIL home page