(data stored in ACNUC7421 zone)

EMBL: CP001069.PE135

CP001069.PE135       Location/Qualifiers
FT   CDS             151579..152361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3904"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rso:RS04702 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3904"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29011"
FT                   /db_xref="GOA:B2UHG0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG0"
FT                   /protein_id="ACD29011.1"
FT                   /translation="MTSHAVFTGLINLLLGMGLGVAGGLLGIGGGLIAIPLLGYLYGMD
FT                   QHLAQGTALVMIAPNVLIGFWRYHQRHPVHVRSVALICVFSMGATYVAARFAAGLDANL
FT                   LHTAFAVFLIVLAVYFASQLKEKPNAAGAAHAVPHTMPAAALPLMGIASGAMSGIFTVG
FT                   GGLVVVSALVTFFGMPQTRAQGMALALVVPGSLIALAAYAHAGHVDWGTGIPLAAGGVV
FT                   SVSWGVALAYRFSARRLRLAFCAVLLGTALMMLLVKPA"
     MTSHAVFTGL INLLLGMGLG VAGGLLGIGG GLIAIPLLGY LYGMDQHLAQ GTALVMIAPN        60
     VLIGFWRYHQ RHPVHVRSVA LICVFSMGAT YVAARFAAGL DANLLHTAFA VFLIVLAVYF       120
     ASQLKEKPNA AGAAHAVPHT MPAAALPLMG IASGAMSGIF TVGGGLVVVS ALVTFFGMPQ       180
     TRAQGMALAL VVPGSLIALA AYAHAGHVDW GTGIPLAAGG VVSVSWGVAL AYRFSARRLR       240
     LAFCAVLLGT ALMMLLVKPA                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page