(data stored in SCRATCH zone)

EMBL: CP001069.PE139

CP001069.PE139       Location/Qualifiers
FT   CDS             complement(153991..154494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3908"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rso:RS05225 probable acyl-CoA thioester hydrolase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3908"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29015"
FT                   /db_xref="GOA:B2UHG4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG4"
FT                   /protein_id="ACD29015.1"
FT                   /translation="MNTQSHQLSMTVLMTPDMANFSGNVHGGHILKLLDQVAYACASRY
FT                   AGRYVVTLSVDQVVFRQPIHVGELVTFLASVNYTGRTSMEIGIKVVTENIRNQVVRHTN
FT                   SCYFTMVAVDDDGKPADVPPLAPANAEERERFEAAQQRRALRQEMEARHKAIKATYSTP
FT                   VSGG"
     MNTQSHQLSM TVLMTPDMAN FSGNVHGGHI LKLLDQVAYA CASRYAGRYV VTLSVDQVVF        60
     RQPIHVGELV TFLASVNYTG RTSMEIGIKV VTENIRNQVV RHTNSCYFTM VAVDDDGKPA       120
     DVPPLAPANA EERERFEAAQ QRRALRQEME ARHKAIKATY STPVSGG                     167
//

If you have problems or comments...

PBIL Back to PBIL home page