(data stored in SCRATCH zone)

EMBL: CP001069.PE140

CP001069.PE140       Location/Qualifiers
FT   CDS             154540..155064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3909"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: har:HEAR1579 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3909"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29016"
FT                   /db_xref="GOA:B2UHG5"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG5"
FT                   /protein_id="ACD29016.1"
FT                   /translation="MGTQQADIVPRSTHLVLHCVKFDGIALHYRFARQTIFSPLLLSMH
FT                   RFLTRLLLWLVVLALPLQGLAATTMMARGGALDDTTVAVAMLDDGAVMSDACHEHEDAM
FT                   ATGAESKAPAQSHCKTCPICAACSLGSVVPLAASLGVPLIKLPAAAPRGLAVSFRSFIP
FT                   EALQRPPSIRV"
     MGTQQADIVP RSTHLVLHCV KFDGIALHYR FARQTIFSPL LLSMHRFLTR LLLWLVVLAL        60
     PLQGLAATTM MARGGALDDT TVAVAMLDDG AVMSDACHEH EDAMATGAES KAPAQSHCKT       120
     CPICAACSLG SVVPLAASLG VPLIKLPAAA PRGLAVSFRS FIPEALQRPP SIRV             174
//

If you have problems or comments...

PBIL Back to PBIL home page