(data stored in ACNUC7421 zone)

EMBL: CP001069.PE141

CP001069.PE141       Location/Qualifiers
FT   CDS             155161..155502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3910"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_6293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3910"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29017"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG6"
FT                   /protein_id="ACD29017.1"
FT                   /translation="MLFTRWFVAAALLALAPPWVLAQGAGSAPAASPPDPLNADAAVPA
FT                   VAAPRTFDSYHAYRDTGPAPWRETNAAVSSKSDASADGGHAGHVIPASAPAATSNKPAG
FT                   ESMPGMHHH"
     MLFTRWFVAA ALLALAPPWV LAQGAGSAPA ASPPDPLNAD AAVPAVAAPR TFDSYHAYRD        60
     TGPAPWRETN AAVSSKSDAS ADGGHAGHVI PASAPAATSN KPAGESMPGM HHH              113
//

If you have problems or comments...

PBIL Back to PBIL home page