(data stored in ACNUC7421 zone)

EMBL: CP001069.PE144

CP001069.PE144       Location/Qualifiers
FT   CDS             158267..158755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3913"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   pna:Pnap_1260 blue (type 1) copper domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3913"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29020"
FT                   /db_xref="GOA:B2UHG9"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG9"
FT                   /protein_id="ACD29020.1"
FT                   /translation="MQRNLLRSTFLAALMSMAAIAHASGNHAGGHDHGDAAIGEPGDAA
FT                   RITRMVHVDMTDTMRFTPAQITVQRGETIRFEVVSSGQVRHEMTLGTPADLLAHAEQMR
FT                   RHPEMEHADANAVTVDPGQRGEIVWHFTHAGSVEFACLQPGHFEAGMRGAVQVRGNKS"
     MQRNLLRSTF LAALMSMAAI AHASGNHAGG HDHGDAAIGE PGDAARITRM VHVDMTDTMR        60
     FTPAQITVQR GETIRFEVVS SGQVRHEMTL GTPADLLAHA EQMRRHPEME HADANAVTVD       120
     PGQRGEIVWH FTHAGSVEFA CLQPGHFEAG MRGAVQVRGN KS                          162
//

If you have problems or comments...

PBIL Back to PBIL home page