(data stored in ACNUC7421 zone)

EMBL: CP001069.PE145

CP001069.PE145       Location/Qualifiers
FT   CDS             158791..159117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3914"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_6290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3914"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29021"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH0"
FT                   /protein_id="ACD29021.1"
FT                   /translation="MFRHALMLTALLVGTPLVHAAEDTAPAPAPAATTPAAMSEGEIRK
FT                   IDTVAGKLTIKHGPLDNLGMEPMTMVFRVQDPAMLTKVQVGSKVHFVAEKVNGALTVTA
FT                   LDVQ"
     MFRHALMLTA LLVGTPLVHA AEDTAPAPAP AATTPAAMSE GEIRKIDTVA GKLTIKHGPL        60
     DNLGMEPMTM VFRVQDPAML TKVQVGSKVH FVAEKVNGAL TVTALDVQ                    108
//

If you have problems or comments...

PBIL Back to PBIL home page