(data stored in SCRATCH zone)

EMBL: CP001069.PE149

CP001069.PE149       Location/Qualifiers
FT   CDS             161976..162416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3918"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3918"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29025"
FT                   /db_xref="InterPro:IPR018673"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH4"
FT                   /protein_id="ACD29025.1"
FT                   /translation="MSAMFALPRVALALMLATLAASVSAATLTVVVEGAQGRQGAVRAA
FT                   LFRDAAGWLKPDSAIRADIAALDSVSGASVTFVYPDLPAGRYALSVFHDTNNDGKLGTN
FT                   PAGIPVEPYGFSRDARGRFGPPAFDDAAIDVQGDQRVTIHLH"
     MSAMFALPRV ALALMLATLA ASVSAATLTV VVEGAQGRQG AVRAALFRDA AGWLKPDSAI        60
     RADIAALDSV SGASVTFVYP DLPAGRYALS VFHDTNNDGK LGTNPAGIPV EPYGFSRDAR       120
     GRFGPPAFDD AAIDVQGDQR VTIHLH                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page