(data stored in SCRATCH zone)

EMBL: CP001069.PE15

CP001069.PE15        Location/Qualifiers
FT   CDS             complement(13506..13937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3775"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3775"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28891"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH40"
FT                   /protein_id="ACD28891.1"
FT                   /translation="MIPHRDAVVCGANQRDATSAGASPPRPPAAEREECVDAVLGKPEQ
FT                   DIPERRTADRPPHARDERLEAQRSGPRADIEQAARDIDSGQLDTDLHNTPGVERVVREH
FT                   HAANREDPDRRVANRSADDLADKRNEAGRPGPSRAERKP"
     MIPHRDAVVC GANQRDATSA GASPPRPPAA EREECVDAVL GKPEQDIPER RTADRPPHAR        60
     DERLEAQRSG PRADIEQAAR DIDSGQLDTD LHNTPGVERV VREHHAANRE DPDRRVANRS       120
     ADDLADKRNE AGRPGPSRAE RKP                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page