(data stored in ACNUC7421 zone)

EMBL: CP001069.PE150

CP001069.PE150       Location/Qualifiers
FT   CDS             162436..163962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3919"
FT                   /product="Carotenoid oxygenase"
FT                   /note="PFAM: Carotenoid oxygenase; KEGG: rso:RS05214
FT                   probable dioxygenase signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3919"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29026"
FT                   /db_xref="GOA:B2UHH5"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH5"
FT                   /protein_id="ACD29026.1"
FT                   /translation="MQRRSFIAALGAAPFGLTLTDVMAATPDPWAAGFAAARAQYPWLA
FT                   GYQGVSADMPTRALKVEGRFPPALHGAFYRNGPARHEIGGVRYHHLFDGDGMIQRYDIS
FT                   EQGVTHRGVFVRTDKFVADTAAGRPLRATFGTANPDMEPVASPDSINVANTSLVMHGDE
FT                   MLALWEGGSATRVDPDSLRTLGVQTWRDDYKGMPFSAHPKVEPDGTLWNFGVSSAAGLL
FT                   TVYCVGADAALKRVESVNVPDVAMVHDFAVTQRHLVFLLPPFVYDVERSHAGMSFLDSH
FT                   VWRPELGMRVLVLDKDDITRMRWLKLPEGFVFHLGNAWSSPDGQEIHLDYLRSDDASVV
FT                   ITSLRELMRGQIRPSPGARLTQVQLNLRTGRAEQFSTAHVAEFPKIDTRRTAQRHRALF
FT                   MVAHTAPLSNGSPHALHGFDTVMRVDTDSGQAEQYRFGHRTLVEEHVFVPASASAREGE
FT                   GWLIGTVFDVDAGCTRLTAFDAQHVAAGPVATASLNGVAPLGLHGLFRAA"
     MQRRSFIAAL GAAPFGLTLT DVMAATPDPW AAGFAAARAQ YPWLAGYQGV SADMPTRALK        60
     VEGRFPPALH GAFYRNGPAR HEIGGVRYHH LFDGDGMIQR YDISEQGVTH RGVFVRTDKF       120
     VADTAAGRPL RATFGTANPD MEPVASPDSI NVANTSLVMH GDEMLALWEG GSATRVDPDS       180
     LRTLGVQTWR DDYKGMPFSA HPKVEPDGTL WNFGVSSAAG LLTVYCVGAD AALKRVESVN       240
     VPDVAMVHDF AVTQRHLVFL LPPFVYDVER SHAGMSFLDS HVWRPELGMR VLVLDKDDIT       300
     RMRWLKLPEG FVFHLGNAWS SPDGQEIHLD YLRSDDASVV ITSLRELMRG QIRPSPGARL       360
     TQVQLNLRTG RAEQFSTAHV AEFPKIDTRR TAQRHRALFM VAHTAPLSNG SPHALHGFDT       420
     VMRVDTDSGQ AEQYRFGHRT LVEEHVFVPA SASAREGEGW LIGTVFDVDA GCTRLTAFDA       480
     QHVAAGPVAT ASLNGVAPLG LHGLFRAA                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page