(data stored in ACNUC7421 zone)

EMBL: CP001069.PE151

CP001069.PE151       Location/Qualifiers
FT   CDS             complement(163975..165468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3920"
FT                   /product="peptidase dimerisation domain protein"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: dac:Daci_1258 peptidase dimerisation domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3920"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29027"
FT                   /db_xref="GOA:B2UHH6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH6"
FT                   /protein_id="ACD29027.1"
FT                   /translation="MLGATGLAGAAELSSADAERHAQATYREYFQLLSLPNDAIVPEDV
FT                   RKNADWLEQAFRKRGFTTKQLANNGKPMLYAELPNPDAGRKTVLFYMHLDGQPVIPAQW
FT                   AQKSPWTPVLKHKTAQGDWEEIDAAQLFSGPLDPEWRVFGRSSADDKGPIMMMLAAIDA
FT                   LKASGAQPAVNVKIILDSEEEKGSPSISKVMQANRELLRCDAIVIHDGPMHASNLPTLV
FT                   FGNRGAAEARLTVYGAKVPLHSGHYGNYARNPAQQLANLLASMKNDAGRVTVPGYYDHV
FT                   KISEADRKIMAAVPDDQAALNKRLGIAHADKVGANYQEAMQYPSLNVRGMASAAVGDKV
FT                   ANIVPDKAVAELDLRTTPDSSAAYLGKLIERHIERQGYHLVKNAPTDEERSRYDKLATF
FT                   TYQSEGADAAGSPIDSAVGTWAYRSLTDTFGANPAPVRIRMMGGTVPTAEIVGVLQVPF
FT                   AIIPLVNADNNQHAANENLRMGNYVGGVRTIYGLLTHPL"
     MLGATGLAGA AELSSADAER HAQATYREYF QLLSLPNDAI VPEDVRKNAD WLEQAFRKRG        60
     FTTKQLANNG KPMLYAELPN PDAGRKTVLF YMHLDGQPVI PAQWAQKSPW TPVLKHKTAQ       120
     GDWEEIDAAQ LFSGPLDPEW RVFGRSSADD KGPIMMMLAA IDALKASGAQ PAVNVKIILD       180
     SEEEKGSPSI SKVMQANREL LRCDAIVIHD GPMHASNLPT LVFGNRGAAE ARLTVYGAKV       240
     PLHSGHYGNY ARNPAQQLAN LLASMKNDAG RVTVPGYYDH VKISEADRKI MAAVPDDQAA       300
     LNKRLGIAHA DKVGANYQEA MQYPSLNVRG MASAAVGDKV ANIVPDKAVA ELDLRTTPDS       360
     SAAYLGKLIE RHIERQGYHL VKNAPTDEER SRYDKLATFT YQSEGADAAG SPIDSAVGTW       420
     AYRSLTDTFG ANPAPVRIRM MGGTVPTAEI VGVLQVPFAI IPLVNADNNQ HAANENLRMG       480
     NYVGGVRTIY GLLTHPL                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page