(data stored in ACNUC7421 zone)

EMBL: CP001069.PE154

CP001069.PE154       Location/Qualifiers
FT   CDS             complement(168140..168913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3923"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: reh:H16_B2488
FT                   ABC-type transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3923"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29030"
FT                   /db_xref="GOA:B2UHH9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH9"
FT                   /protein_id="ACD29030.1"
FT                   /translation="MTTEAVLLHLRYLLIGPYPNGPLAGAALTLWMALWACVMATAAGV
FT                   GCALLLDRLDATPGLRRLARLLRGLLATLRAIPVLMLMFWAYFLIPMALGVSVPETATV
FT                   VAALAAVGAAYITQSMEAGLRAVGAGQRNAALALGMSPPQALLTVVLPQAWRIMLPSLA
FT                   NQWVSTVKDTSLAYIVGVVELSTAASQVNSRTVAYPAEVFGAVAVLYFLLCTGIEALPN
FT                   WLRAGPRTPAAQPDHMSTWQRFLRWRERPVSDAVT"
     MTTEAVLLHL RYLLIGPYPN GPLAGAALTL WMALWACVMA TAAGVGCALL LDRLDATPGL        60
     RRLARLLRGL LATLRAIPVL MLMFWAYFLI PMALGVSVPE TATVVAALAA VGAAYITQSM       120
     EAGLRAVGAG QRNAALALGM SPPQALLTVV LPQAWRIMLP SLANQWVSTV KDTSLAYIVG       180
     VVELSTAASQ VNSRTVAYPA EVFGAVAVLY FLLCTGIEAL PNWLRAGPRT PAAQPDHMST       240
     WQRFLRWRER PVSDAVT                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page