(data stored in SCRATCH zone)

EMBL: CP001069.PE155

CP001069.PE155       Location/Qualifiers
FT   CDS             complement(168910..169602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3924"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: reh:H16_B2489
FT                   ABC-type transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3924"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29031"
FT                   /db_xref="GOA:B2UHI0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI0"
FT                   /protein_id="ACD29031.1"
FT                   /translation="MTLLVSAAAIAGGLAIGLLLTALRASAQPWLHLPARALVAFLRKT
FT                   PLLVQLFFWYFGAAQLLGEDVVGAIIGWGGIAVGAWRLPAPSFEFLAAAFGIALYAGAF
FT                   FSEELRAGIRAVPRGQREAALSLGFTPRAAFLRVVLPQALRVSALPLLGQCANTIKNTS
FT                   LAMGIGLAELAYSARQVETDTLLAFQAFAVATVLYAGVILLLQWVAPRVLRRLGWTSTS
FT                   TLPDGAPA"
     MTLLVSAAAI AGGLAIGLLL TALRASAQPW LHLPARALVA FLRKTPLLVQ LFFWYFGAAQ        60
     LLGEDVVGAI IGWGGIAVGA WRLPAPSFEF LAAAFGIALY AGAFFSEELR AGIRAVPRGQ       120
     REAALSLGFT PRAAFLRVVL PQALRVSALP LLGQCANTIK NTSLAMGIGL AELAYSARQV       180
     ETDTLLAFQA FAVATVLYAG VILLLQWVAP RVLRRLGWTS TSTLPDGAPA                  230
//

If you have problems or comments...

PBIL Back to PBIL home page