(data stored in ACNUC7421 zone)

EMBL: CP001069.PE16

CP001069.PE16        Location/Qualifiers
FT   CDS             complement(14139..15458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3776"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   aav:Aave_2002 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3776"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28892"
FT                   /db_xref="GOA:B2UH41"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH41"
FT                   /protein_id="ACD28892.1"
FT                   /translation="MPRPRGTGRTTFLAMSDPLPTHSTQAPPGPGPAPQPTLLTGLQQP
FT                   AWRLAMVLVAIGGTLVFLQWARVFLVPLTFGVVLAFALNPLVVRLQHWYVPRPVAAAVI
FT                   VLGLWLAGGAVVFGMQDGVSAVAERVPLAAERMAESVDRVRDRLSGAVDKMRQVTTAVE
FT                   HATEGVPAKPPSQPARRPAAAAPPAPHDTLPVLPLREFVWTGSASLFALAGQLVVVSFL
FT                   VYFLLASGQALKRKWVRAVGRTLSEKKRAVRMMAGIGTQIQYSLLVLFASNIMLGILTA
FT                   VAFALLGMDDATVWGLAAAVLHFVPYLGSVVMVVASGIGAYLQMGTWADALIVAGTTLV
FT                   FATLVGTLLMTWLQSRASKLDPCVVYIGLLLWGWLWGVWGLLLGTSVTAMIKVVCDHVE
FT                   RLRPLGVLLGTTDAPAGVWQRLLDRLRGRPTRRRQGAPRR"
     MPRPRGTGRT TFLAMSDPLP THSTQAPPGP GPAPQPTLLT GLQQPAWRLA MVLVAIGGTL        60
     VFLQWARVFL VPLTFGVVLA FALNPLVVRL QHWYVPRPVA AAVIVLGLWL AGGAVVFGMQ       120
     DGVSAVAERV PLAAERMAES VDRVRDRLSG AVDKMRQVTT AVEHATEGVP AKPPSQPARR       180
     PAAAAPPAPH DTLPVLPLRE FVWTGSASLF ALAGQLVVVS FLVYFLLASG QALKRKWVRA       240
     VGRTLSEKKR AVRMMAGIGT QIQYSLLVLF ASNIMLGILT AVAFALLGMD DATVWGLAAA       300
     VLHFVPYLGS VVMVVASGIG AYLQMGTWAD ALIVAGTTLV FATLVGTLLM TWLQSRASKL       360
     DPCVVYIGLL LWGWLWGVWG LLLGTSVTAM IKVVCDHVER LRPLGVLLGT TDAPAGVWQR       420
     LLDRLRGRPT RRRQGAPRR                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page