(data stored in ACNUC7421 zone)

EMBL: CP001069.PE161

CP001069.PE161       Location/Qualifiers
FT   CDS             complement(176644..177891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3932"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: rso:RS05189 probable
FT                   metabolite transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3932"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29037"
FT                   /db_xref="GOA:B2UHI6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI6"
FT                   /protein_id="ACD29037.1"
FT                   /translation="MFGWFKEISKGEKRTFWACFGGWALDALDVQMFSLVIPTIIAAWH
FT                   IGKAEAGLVSGITLVASALGGWIAGALTDRFGRVRTLQITVLWFSLATFASAFAQNFEQ
FT                   FLVLKAIQGFGFGGEWAAGAVLMAESIRASHRGKAMGTVQSAWAVGWGAAVLLYALTYS
FT                   FIEPDLAWRVMFAAGLLPALLIIYIRRGVQEPVPAATPDANANAMPISRFPLLDIFRPQ
FT                   VLRMTLIGGLLGVGAHGGYYALMTWLPTYLKTERHLSVLGTGGYLAVIIFAFWCGCVAS
FT                   AWLLDVLGRRGNILLFSCCCVVTVLVYLLVPLSDGAMLVLGFPLGFFAAGIPASMGALF
FT                   NELYPQGVRGTGVGFCYNFGRVVSAAFPVLVGKMSASMSLGTAIGIDAAIAYSIVAVAV
FT                   LMLPETKGRDLAAVTV"
     MFGWFKEISK GEKRTFWACF GGWALDALDV QMFSLVIPTI IAAWHIGKAE AGLVSGITLV        60
     ASALGGWIAG ALTDRFGRVR TLQITVLWFS LATFASAFAQ NFEQFLVLKA IQGFGFGGEW       120
     AAGAVLMAES IRASHRGKAM GTVQSAWAVG WGAAVLLYAL TYSFIEPDLA WRVMFAAGLL       180
     PALLIIYIRR GVQEPVPAAT PDANANAMPI SRFPLLDIFR PQVLRMTLIG GLLGVGAHGG       240
     YYALMTWLPT YLKTERHLSV LGTGGYLAVI IFAFWCGCVA SAWLLDVLGR RGNILLFSCC       300
     CVVTVLVYLL VPLSDGAMLV LGFPLGFFAA GIPASMGALF NELYPQGVRG TGVGFCYNFG       360
     RVVSAAFPVL VGKMSASMSL GTAIGIDAAI AYSIVAVAVL MLPETKGRDL AAVTV            415
//

If you have problems or comments...

PBIL Back to PBIL home page