(data stored in SCRATCH zone)

EMBL: CP001069.PE164

CP001069.PE164       Location/Qualifiers
FT   CDS             complement(183167..185008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3935"
FT                   /product="malto-oligosyltrehalose trehalohydrolase"
FT                   /note="KEGG: rso:RS05186 putative maltooligosyl trehalose
FT                   trehalohydrolase protein; TIGRFAM: malto-oligosyltrehalose
FT                   trehalohydrolase; PFAM: glycoside hydrolase family 13
FT                   domain protein; alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3935"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29040"
FT                   /db_xref="GOA:B2UHI9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI9"
FT                   /protein_id="ACD29040.1"
FT                   /translation="MTAPAPRFAHDMPFGATVLADGNTRFRLWAPDATAAWIDIDDTRG
FT                   NESIRMDAEPDGWYAAVAPVGSGTCYRYRLTNRDGVTLSVPDPAARAQWQDIPGPSLVV
FT                   DPQRYRWQHADWQGRPWHETVLYELHVGALGGFKGVRGRLPELARLGITAIELMPVAEF
FT                   PGARNWGYDGVLPFAPDASYGTPDDLKALIDTAHGLGMMVFLDVVYNHFGPDGNYLHHY
FT                   ARSFFRDDVHTPWGAAIDFRKPQVREFFIQNALMWLMEYRFDGLRLDAVHAITERDWLG
FT                   ELAARVRLSAEPGRHVHLVLENEHNAASLLRDGNTHGDFDAQWNDDGHNVLHVLLTGER
FT                   EAYYAAYADAPAQRLARVLQDGFCYQGEPSPIHDNAPRGEPSAHLPPTAFVLFLQNHDQ
FT                   IGNRAFGERLTQLAHPDALHAAQVLLLLSPQIPMLFMGEEWGSTCPFQYFTSHHGMLAE
FT                   AVREGRRREFAKFEAFADPHQRERIPDPNEELTYLASCPGEANLAEPAQLNTLNRMHRL
FT                   LALRHAEIIPRLPHARALDAVALGHAGAIARWRMGDGSVLTLMLNLADQPVAVPTVLAG
FT                   SPADLLHESREGAAAALITHRLPERACVALLHTPSPG"
     MTAPAPRFAH DMPFGATVLA DGNTRFRLWA PDATAAWIDI DDTRGNESIR MDAEPDGWYA        60
     AVAPVGSGTC YRYRLTNRDG VTLSVPDPAA RAQWQDIPGP SLVVDPQRYR WQHADWQGRP       120
     WHETVLYELH VGALGGFKGV RGRLPELARL GITAIELMPV AEFPGARNWG YDGVLPFAPD       180
     ASYGTPDDLK ALIDTAHGLG MMVFLDVVYN HFGPDGNYLH HYARSFFRDD VHTPWGAAID       240
     FRKPQVREFF IQNALMWLME YRFDGLRLDA VHAITERDWL GELAARVRLS AEPGRHVHLV       300
     LENEHNAASL LRDGNTHGDF DAQWNDDGHN VLHVLLTGER EAYYAAYADA PAQRLARVLQ       360
     DGFCYQGEPS PIHDNAPRGE PSAHLPPTAF VLFLQNHDQI GNRAFGERLT QLAHPDALHA       420
     AQVLLLLSPQ IPMLFMGEEW GSTCPFQYFT SHHGMLAEAV REGRRREFAK FEAFADPHQR       480
     ERIPDPNEEL TYLASCPGEA NLAEPAQLNT LNRMHRLLAL RHAEIIPRLP HARALDAVAL       540
     GHAGAIARWR MGDGSVLTLM LNLADQPVAV PTVLAGSPAD LLHESREGAA AALITHRLPE       600
     RACVALLHTP SPG                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page