(data stored in ACNUC7421 zone)

EMBL: CP001069.PE168

CP001069.PE168       Location/Qualifiers
FT   CDS             complement(193691..197281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3939"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: rso:RS05182 putative
FT                   alpha-amylase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3939"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29044"
FT                   /db_xref="GOA:B2UHJ3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ3"
FT                   /protein_id="ACD29044.1"
FT                   /translation="MPETKSPKPATSRKTTAALKAAKPPGSKAKSATKPTAMPSERPPA
FT                   ATQPPYAPAICYVHPLQLGRLDRWDGVLDRIASLGFDHVLMAPPFAVGAAGNVFVTRDH
FT                   AQLHAALGGGPADAALATLAEGCRARGLTLQLDLVIDRVAIDAPLRADHPDWFASHAED
FT                   GDALDPRLPPSHLEVASFRHDDPRCADAILMWWTQQLRAWAALGIGGFRCEAPARLPAA
FT                   RWRTLIADVRKDVGVIRFLAWTPGMDGAAVDALAGAGFDATFSSLRWWDFRAGWMVEEH
FT                   ARLAAVAPPIAAVEAPFGTRYGQAFGDAMIRERAYRRLLHVADTLDAGWLMPLGFERGA
FT                   LLPMLAERGDPSDQQWIDAHAAFDLSDAVRDVNATIRAARETNTVAPHAELRMLTGPDA
FT                   PATALLRADGPDLRAGDAATLTVINPDLYMGVSVHADHFLPGVAGGFTRGVALDLLTEP
FT                   VGSCDDTLRARARPLAEIDLLPGDVQVWRVFRNAPVRTPAAVKPAKSLRTKAGEAKEPV
FT                   NAAIASPRIGIEQVQPSVEDGRFAVKRLVGDDIIVEADVLMDGHDKLAVHLLWRAQDED
FT                   TWQHVPMMPLGNDRWRGAFRPERLGRHVYAVAAWRDAFGTYRSELEKKHTAGVEVTLEL
FT                   EEGARLVALAAEHAPNDAPVDALHKLARLLAEADQAHRLKLLLDPVTEHVMAQASHYRP
FT                   FYVESVAYPLDVERAGAAFASWYKLFPRSASDDEQRHGTFDDVIRRLGAIRGMGFDVLY
FT                   FPPIHPIGRTNRKGRNNSLRAEPDDPGSPYAIGATEGGHDAIHPQLGTLEDFRRLMRAA
FT                   REKGLELALDFAIQCSPDHPWLREHPGWFAWRPDGSIKYAENPPKKYEDIVNVDFYADD
FT                   AKPGLWTALRDVVMFWADEGVRLFRVDNPHTKPLPFWEWMIGEVRARYPDTVFLSEAFT
FT                   RPKVMYRLAKVGFSQSYTYFTWRHTKQEFIDYLTELTRTPVREYFRPHFFVNTPDINPV
FT                   FLQTSGRPGFLIRAALAATLSGLWGVYNGFELCEGAAVPGKEEYLDSEKYQLRAWDHNR
FT                   PGNIVKEIALLNRIRRANPALHSHLGVTFQPASGDRILFFSKSTPPVLPAQLETSQAEP
FT                   ANALSPDRFGDNTVFVAINLDPHHAHESDIELPLWQWGLPDHGALMAENLVNGQRTVWR
FT                   GKWQHIRLEPEHPFAIWRVRPALPSEEQPS"
     MPETKSPKPA TSRKTTAALK AAKPPGSKAK SATKPTAMPS ERPPAATQPP YAPAICYVHP        60
     LQLGRLDRWD GVLDRIASLG FDHVLMAPPF AVGAAGNVFV TRDHAQLHAA LGGGPADAAL       120
     ATLAEGCRAR GLTLQLDLVI DRVAIDAPLR ADHPDWFASH AEDGDALDPR LPPSHLEVAS       180
     FRHDDPRCAD AILMWWTQQL RAWAALGIGG FRCEAPARLP AARWRTLIAD VRKDVGVIRF       240
     LAWTPGMDGA AVDALAGAGF DATFSSLRWW DFRAGWMVEE HARLAAVAPP IAAVEAPFGT       300
     RYGQAFGDAM IRERAYRRLL HVADTLDAGW LMPLGFERGA LLPMLAERGD PSDQQWIDAH       360
     AAFDLSDAVR DVNATIRAAR ETNTVAPHAE LRMLTGPDAP ATALLRADGP DLRAGDAATL       420
     TVINPDLYMG VSVHADHFLP GVAGGFTRGV ALDLLTEPVG SCDDTLRARA RPLAEIDLLP       480
     GDVQVWRVFR NAPVRTPAAV KPAKSLRTKA GEAKEPVNAA IASPRIGIEQ VQPSVEDGRF       540
     AVKRLVGDDI IVEADVLMDG HDKLAVHLLW RAQDEDTWQH VPMMPLGNDR WRGAFRPERL       600
     GRHVYAVAAW RDAFGTYRSE LEKKHTAGVE VTLELEEGAR LVALAAEHAP NDAPVDALHK       660
     LARLLAEADQ AHRLKLLLDP VTEHVMAQAS HYRPFYVESV AYPLDVERAG AAFASWYKLF       720
     PRSASDDEQR HGTFDDVIRR LGAIRGMGFD VLYFPPIHPI GRTNRKGRNN SLRAEPDDPG       780
     SPYAIGATEG GHDAIHPQLG TLEDFRRLMR AAREKGLELA LDFAIQCSPD HPWLREHPGW       840
     FAWRPDGSIK YAENPPKKYE DIVNVDFYAD DAKPGLWTAL RDVVMFWADE GVRLFRVDNP       900
     HTKPLPFWEW MIGEVRARYP DTVFLSEAFT RPKVMYRLAK VGFSQSYTYF TWRHTKQEFI       960
     DYLTELTRTP VREYFRPHFF VNTPDINPVF LQTSGRPGFL IRAALAATLS GLWGVYNGFE      1020
     LCEGAAVPGK EEYLDSEKYQ LRAWDHNRPG NIVKEIALLN RIRRANPALH SHLGVTFQPA      1080
     SGDRILFFSK STPPVLPAQL ETSQAEPANA LSPDRFGDNT VFVAINLDPH HAHESDIELP      1140
     LWQWGLPDHG ALMAENLVNG QRTVWRGKWQ HIRLEPEHPF AIWRVRPALP SEEQPS          1196
//

If you have problems or comments...

PBIL Back to PBIL home page