(data stored in ACNUC7421 zone)

EMBL: CP001069.PE169

CP001069.PE169       Location/Qualifiers
FT   CDS             complement(197313..198944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3940"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: rso:RSp0242 glycogen
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3940"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29045"
FT                   /db_xref="GOA:B2UHJ4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ4"
FT                   /protein_id="ACD29045.1"
FT                   /translation="MTLSLNVLFVASEAVPLAKTGGLGDMVGACANALRRAGMKVTVML
FT                   PGYPDAITQLQHTRTVCEWTDLPGGPARLLSGHMGAQGIPVLLFDAPALFARPGNPYLD
FT                   AHGEPYEDNALRFASFSQAAARVAGGVPGVHRSDTVQAHDWHAGLVPLFVKRAQAPVKT
FT                   VFTIHNLAFQGNFPMHVVPDIGVPPDAAHEAEFWGQFSFLKAGLLWADRITTVSHAYAR
FT                   EILTDTAGCGMQDLLRARQRDLIAILNGIDNDVWNPSKDPLLPQPFVASNLSGKHTAKR
FT                   VLQQRFGLPEDAKAPLLAVGSRLTHQKMADVTLQALPQLLESNPQLQVAVLGCGEHAYE
FT                   TGMADLAARYPRQVAAKIGYTEAFAHLLHAGADILLHGSRFEPCGLTPLYSMRYGTVPV
FT                   ASRVGGLMDTITDRGSPEAALHGATGFLFDGDTADAMVAAVERALHVFAQPQAWRILQY
FT                   NGMTTDFGWSQPAREYIALYRTLVPAATPMPAVALVQAPVAPDAVHTPRPEQPVRTPAR
FT                   RRSTALSDEIRAHAVARAASAEKIRA"
     MTLSLNVLFV ASEAVPLAKT GGLGDMVGAC ANALRRAGMK VTVMLPGYPD AITQLQHTRT        60
     VCEWTDLPGG PARLLSGHMG AQGIPVLLFD APALFARPGN PYLDAHGEPY EDNALRFASF       120
     SQAAARVAGG VPGVHRSDTV QAHDWHAGLV PLFVKRAQAP VKTVFTIHNL AFQGNFPMHV       180
     VPDIGVPPDA AHEAEFWGQF SFLKAGLLWA DRITTVSHAY AREILTDTAG CGMQDLLRAR       240
     QRDLIAILNG IDNDVWNPSK DPLLPQPFVA SNLSGKHTAK RVLQQRFGLP EDAKAPLLAV       300
     GSRLTHQKMA DVTLQALPQL LESNPQLQVA VLGCGEHAYE TGMADLAARY PRQVAAKIGY       360
     TEAFAHLLHA GADILLHGSR FEPCGLTPLY SMRYGTVPVA SRVGGLMDTI TDRGSPEAAL       420
     HGATGFLFDG DTADAMVAAV ERALHVFAQP QAWRILQYNG MTTDFGWSQP AREYIALYRT       480
     LVPAATPMPA VALVQAPVAP DAVHTPRPEQ PVRTPARRRS TALSDEIRAH AVARAASAEK       540
     IRA                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page