(data stored in ACNUC7421 zone)

EMBL: CP001069.PE17

CP001069.PE17        Location/Qualifiers
FT   CDS             complement(15460..17844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3777"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: rso:RS02235 probable composite two-component
FT                   regulatory (sensor kinase and response regulator hybrid)
FT                   transcription regulator protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3777"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28893"
FT                   /db_xref="GOA:B2UH42"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH42"
FT                   /protein_id="ACD28893.1"
FT                   /translation="MSTSVSGLLAPAHRVPQARVVFFGGKLLDVFWIDDPLTGTRLHVS
FT                   AAAQTWGVRAESLCGDREQWLAHVHPDDHAALRAAWDGLARGQDFVLEYRWIGVDHREQ
FT                   RVRERGYLMPSPNGGPAHAVGVIEDVTQRQQTLTALTESEFQLQWLTESVPFPLVQIDP
FT                   EHRVRFANRAYAQRFGMLPDAVVGSHLRAVMGEAAYARILAHLGEGFAGRRVDFEIELP
FT                   YPEDIGSRFVHAAYSPQQGPDGSVQALVCLEEDITERKEAERERYRHQREFVTLVENAP
FT                   DVIARLDRDLHCVYVNCAVIHAFGVTPAAMTGRTLSASPLPATVAGPLDAAARLAFTTG
FT                   AEQTLTLHLDAGERRTGIAHYNVRVIPEEDRTGTIESAMLIVYDVTERTEAERERDALL
FT                   LREQTARAHAEAATLARDQFLAVVSHELRSPLNGIQNWTYVLENQLSDGSPLVQRALAG
FT                   IKTGVEQQVRLIEDLLDATRVMSGKLRLTREPFVLSLAIERALNSVRALAAERGITLHV
FT                   ASLLEAHEIDGDADRVEQIVWNLLTNAIKFTHEGGDVWLSADLVGEVARIVVRDNGRGI
FT                   GPAFLPYLFDPFRQADGAHTRRTGGLGLGLALVKRLTELHGGRVHAHSDGERSGAVFTV
FT                   YLPLHAGAELTPPLAEDLARSGPLPSLAGLRVLLVDDQQDARDALATLLAQVGADVASV
FT                   GSGQEAMTQLDTWGVPARPRAVVCDIALPDEDGYAILQKIRTWERLHVPAGASPIAAIA
FT                   LTAFAQPDDRARALASGFQEHLVKPVSPYDLVRTLRNLAAP"
     MSTSVSGLLA PAHRVPQARV VFFGGKLLDV FWIDDPLTGT RLHVSAAAQT WGVRAESLCG        60
     DREQWLAHVH PDDHAALRAA WDGLARGQDF VLEYRWIGVD HREQRVRERG YLMPSPNGGP       120
     AHAVGVIEDV TQRQQTLTAL TESEFQLQWL TESVPFPLVQ IDPEHRVRFA NRAYAQRFGM       180
     LPDAVVGSHL RAVMGEAAYA RILAHLGEGF AGRRVDFEIE LPYPEDIGSR FVHAAYSPQQ       240
     GPDGSVQALV CLEEDITERK EAERERYRHQ REFVTLVENA PDVIARLDRD LHCVYVNCAV       300
     IHAFGVTPAA MTGRTLSASP LPATVAGPLD AAARLAFTTG AEQTLTLHLD AGERRTGIAH       360
     YNVRVIPEED RTGTIESAML IVYDVTERTE AERERDALLL REQTARAHAE AATLARDQFL       420
     AVVSHELRSP LNGIQNWTYV LENQLSDGSP LVQRALAGIK TGVEQQVRLI EDLLDATRVM       480
     SGKLRLTREP FVLSLAIERA LNSVRALAAE RGITLHVASL LEAHEIDGDA DRVEQIVWNL       540
     LTNAIKFTHE GGDVWLSADL VGEVARIVVR DNGRGIGPAF LPYLFDPFRQ ADGAHTRRTG       600
     GLGLGLALVK RLTELHGGRV HAHSDGERSG AVFTVYLPLH AGAELTPPLA EDLARSGPLP       660
     SLAGLRVLLV DDQQDARDAL ATLLAQVGAD VASVGSGQEA MTQLDTWGVP ARPRAVVCDI       720
     ALPDEDGYAI LQKIRTWERL HVPAGASPIA AIALTAFAQP DDRARALASG FQEHLVKPVS       780
     PYDLVRTLRN LAAP                                                         794
//

If you have problems or comments...

PBIL Back to PBIL home page