(data stored in SCRATCH zone)

EMBL: CP001069.PE170

CP001069.PE170       Location/Qualifiers
FT   CDS             199347..199910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3941"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: rso:RSp0245 probable alkyl hydroperoxide
FT                   reductase (subunit C) oxidoreductase protein; TIGRFAM:
FT                   peroxiredoxin; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3941"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29046"
FT                   /db_xref="GOA:B2UHJ5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ5"
FT                   /protein_id="ACD29046.1"
FT                   /translation="MSLINTQVQPFKAQAFHNGKFIEVTDESLKGKWSVLIFMPAAFTF
FT                   NCPTEVEDAADNYAEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLVGDPTHAL
FT                   TNAFGVHIPEEGLALRGTFVIDPQGVIKTMEVHDNAIARDVKETLRKLKAAQFVANNPG
FT                   NVCPAKWNEGAKTIKPSLDLVGKI"
     MSLINTQVQP FKAQAFHNGK FIEVTDESLK GKWSVLIFMP AAFTFNCPTE VEDAADNYAE        60
     FQKAGAEVYI VTTDTHFSHK VWHETSPAVG KAQFPLVGDP THALTNAFGV HIPEEGLALR       120
     GTFVIDPQGV IKTMEVHDNA IARDVKETLR KLKAAQFVAN NPGNVCPAKW NEGAKTIKPS       180
     LDLVGKI                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page