(data stored in ACNUC7421 zone)

EMBL: CP001069.PE171

CP001069.PE171       Location/Qualifiers
FT   CDS             200036..201610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3942"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="TIGRFAM: alkyl hydroperoxide reductase, F subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rso:RSp0246 probable alkyl
FT                   hydroperoxide reductase (subunit F) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3942"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29047"
FT                   /db_xref="GOA:B2UHJ6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ6"
FT                   /protein_id="ACD29047.1"
FT                   /translation="MLDADVKAQLKAYLERLVQPIELVANVDDSEGSRDMMDLLRDVAE
FT                   QSSMIVLTEQRDAAERAPSFLIRRTGADVSVRFAAIPTGHEFTSLVLALLQVGGYAPKL
FT                   EADVIEQIRNIEGDFRFETYMSLTCQNCPDVVQALNVMSVINPRIQHVAIDGALYQGEI
FT                   EARQIMAVPTVFLNGETFGTGRMGVEEILAKIDTGAAARDAEKLAAKEAFDVLIVGGGP
FT                   AGAAAAVYAARKGVRTGVVAERFGGQVLDTLGIENFISVQETEGPKFAAALEQHVRQYD
FT                   VDIMNTQRAVKLTPADKPGGFAEVTLANGAVLKGRSVILSTGARWRNVNVPGEQEYKNK
FT                   GVAYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGLVSHVTLLEFASELKADAVLVRK
FT                   LQSLPNATIVTNAQTTEITGDGQKVNGLRYKSRVDGVEHTVALEGVFVQIGLVPNTEWL
FT                   DGALERNRFGEIVVDARGQTSAEGVFAAGDATTTPYKQIIIATGDGAKAALSAFDHLIR
FT                   VPLAEAA"
     MLDADVKAQL KAYLERLVQP IELVANVDDS EGSRDMMDLL RDVAEQSSMI VLTEQRDAAE        60
     RAPSFLIRRT GADVSVRFAA IPTGHEFTSL VLALLQVGGY APKLEADVIE QIRNIEGDFR       120
     FETYMSLTCQ NCPDVVQALN VMSVINPRIQ HVAIDGALYQ GEIEARQIMA VPTVFLNGET       180
     FGTGRMGVEE ILAKIDTGAA ARDAEKLAAK EAFDVLIVGG GPAGAAAAVY AARKGVRTGV       240
     VAERFGGQVL DTLGIENFIS VQETEGPKFA AALEQHVRQY DVDIMNTQRA VKLTPADKPG       300
     GFAEVTLANG AVLKGRSVIL STGARWRNVN VPGEQEYKNK GVAYCPHCDG PLFKGKRVAV       360
     IGGGNSGVEA AIDLAGLVSH VTLLEFASEL KADAVLVRKL QSLPNATIVT NAQTTEITGD       420
     GQKVNGLRYK SRVDGVEHTV ALEGVFVQIG LVPNTEWLDG ALERNRFGEI VVDARGQTSA       480
     EGVFAAGDAT TTPYKQIIIA TGDGAKAALS AFDHLIRVPL AEAA                        524
//

If you have problems or comments...

PBIL Back to PBIL home page