(data stored in ACNUC7421 zone)

EMBL: CP001069.PE172

CP001069.PE172       Location/Qualifiers
FT   CDS             complement(201688..202575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3943"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pap:PSPA7_2742 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3943"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29048"
FT                   /db_xref="GOA:B2UHJ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ7"
FT                   /protein_id="ACD29048.1"
FT                   /translation="MIDLVLLRSFVTVVDTGNFTRAAEHLHLTQSTVSQQILRLEQQLD
FT                   CRLLDRSQRQVLPTEEGDRLLGYARRLLRLANEASEALSPEHTGGVLRLGVPEDLGSGA
FT                   LMPLIASFARERPRLRLEVESGLSHHLLRLYRNGDLDMLLVKQWGTDSDCHARWAEPVC
FT                   WIDSAERPHTLPLGPSQPSLPLVVFPVGALYRQEMLHALESIGQPWRITYSSPSLASLC
FT                   AAVSAGLGVSLLPASTVQAGHRVLGAADGFPEIGGLELALFARPDLDSAGRALRDRLVE
FT                   MCAARAQALQSAAG"
     MIDLVLLRSF VTVVDTGNFT RAAEHLHLTQ STVSQQILRL EQQLDCRLLD RSQRQVLPTE        60
     EGDRLLGYAR RLLRLANEAS EALSPEHTGG VLRLGVPEDL GSGALMPLIA SFARERPRLR       120
     LEVESGLSHH LLRLYRNGDL DMLLVKQWGT DSDCHARWAE PVCWIDSAER PHTLPLGPSQ       180
     PSLPLVVFPV GALYRQEMLH ALESIGQPWR ITYSSPSLAS LCAAVSAGLG VSLLPASTVQ       240
     AGHRVLGAAD GFPEIGGLEL ALFARPDLDS AGRALRDRLV EMCAARAQAL QSAAG            295
//

If you have problems or comments...

PBIL Back to PBIL home page