(data stored in SCRATCH zone)

EMBL: CP001069.PE175

CP001069.PE175       Location/Qualifiers
FT   CDS             complement(204023..204328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3946"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3946"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29051"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK0"
FT                   /protein_id="ACD29051.1"
FT                   /translation="MTEELLVQLIAEVEKEDPVDFANLPFDEQMLRDLVCKLVSRQLTQ
FT                   MEKAHFSQDEVIVSLTASIAKLVLENLVLNARLLAQQGHGESARALLERISRQAKG"
     MTEELLVQLI AEVEKEDPVD FANLPFDEQM LRDLVCKLVS RQLTQMEKAH FSQDEVIVSL        60
     TASIAKLVLE NLVLNARLLA QQGHGESARA LLERISRQAK G                           101
//

If you have problems or comments...

PBIL Back to PBIL home page