(data stored in SCRATCH zone)

EMBL: CP001069.PE176

CP001069.PE176       Location/Qualifiers
FT   CDS             complement(204435..204755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3947"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS03716 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3947"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29052"
FT                   /db_xref="GOA:B2UHK1"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK1"
FT                   /protein_id="ACD29052.1"
FT                   /translation="MSVYHVVETGVVATVVALSALSLTGRYAPAMRARTAARVAGWCNR
FT                   PSRPGWMRAFGQRLLTPGESPSCHSDPLSGSACGTGCSGCASGDSVSAAPVVQPIHFVR
FT                   RK"
     MSVYHVVETG VVATVVALSA LSLTGRYAPA MRARTAARVA GWCNRPSRPG WMRAFGQRLL        60
     TPGESPSCHS DPLSGSACGT GCSGCASGDS VSAAPVVQPI HFVRRK                      106
//

If you have problems or comments...

PBIL Back to PBIL home page