(data stored in SCRATCH zone)

EMBL: CP001069.PE177

CP001069.PE177       Location/Qualifiers
FT   CDS             complement(204752..206617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3948"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Ferrous iron transport protein B domain
FT                   protein; Ferrous iron transport B domain protein;
FT                   nucleoside recognition domain protein; KEGG: rso:RSp0251
FT                   probable ferrous iron transport B transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3948"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29053"
FT                   /db_xref="GOA:B2UHK2"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK2"
FT                   /protein_id="ACD29053.1"
FT                   /translation="MQMHASSSSASTPALRVALVGNPNCGKTALFNLLTGSRQKVANYA
FT                   GVTVERKEGRFTAPSGRHVQILDLPGAYSLIATSPDEAITRDICLGTFRGESRPDMLIC
FT                   VVDATNLRLHLRFVLELQRLGLPMVLALNMVDAAERRGIRIDRAKLETALGVPVVQTVA
FT                   IKRNGAADLVAHIDHEQLPAVPVGLPADADPHVEVKRLLDTAVTMPRSTAELDDRLDRI
FT                   VLHPVLGLMLLAVLMFFMFQAVFSWAQPLMDGIQGAVEAVGVWVGNVMPDGMLKSLLVN
FT                   GIIAGTGSVLVFLPQILILFLFILSLEESGYLPRAAFLLDRLMAGAGLSGRSFIPLLSS
FT                   FACAIPGVMATRTIQDPRDRLVTILVAPLMTCSARLPVYALLIGAFIPVRKVWGLFNLQ
FT                   GLVLFGLYMAGIVSALVVAYVLKYLKRDRNEHPLILELPSYRLPSVRNLIVGLVERARI
FT                   FLRRIGTVILKMMVLLWFLSTFPAPPANATLPAIDYSFAGMIGRALEVVFAPIGFTWQM
FT                   CIALIPGMAAREVAVGALATVYSLSATHEDAAAQLAPIISQQWSLATALAFLAWYVYAP
FT                   QCISTLATIRRETNSWKVMAGTAGYLFALAYLAAFATYQIARVLT"
     MQMHASSSSA STPALRVALV GNPNCGKTAL FNLLTGSRQK VANYAGVTVE RKEGRFTAPS        60
     GRHVQILDLP GAYSLIATSP DEAITRDICL GTFRGESRPD MLICVVDATN LRLHLRFVLE       120
     LQRLGLPMVL ALNMVDAAER RGIRIDRAKL ETALGVPVVQ TVAIKRNGAA DLVAHIDHEQ       180
     LPAVPVGLPA DADPHVEVKR LLDTAVTMPR STAELDDRLD RIVLHPVLGL MLLAVLMFFM       240
     FQAVFSWAQP LMDGIQGAVE AVGVWVGNVM PDGMLKSLLV NGIIAGTGSV LVFLPQILIL       300
     FLFILSLEES GYLPRAAFLL DRLMAGAGLS GRSFIPLLSS FACAIPGVMA TRTIQDPRDR       360
     LVTILVAPLM TCSARLPVYA LLIGAFIPVR KVWGLFNLQG LVLFGLYMAG IVSALVVAYV       420
     LKYLKRDRNE HPLILELPSY RLPSVRNLIV GLVERARIFL RRIGTVILKM MVLLWFLSTF       480
     PAPPANATLP AIDYSFAGMI GRALEVVFAP IGFTWQMCIA LIPGMAAREV AVGALATVYS       540
     LSATHEDAAA QLAPIISQQW SLATALAFLA WYVYAPQCIS TLATIRRETN SWKVMAGTAG       600
     YLFALAYLAA FATYQIARVL T                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page