(data stored in SCRATCH zone)

EMBL: CP001069.PE178

CP001069.PE178       Location/Qualifiers
FT   CDS             complement(206664..206972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3949"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: rso:RS03714
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3949"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29054"
FT                   /db_xref="GOA:B2UHK3"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK3"
FT                   /protein_id="ACD29054.1"
FT                   /translation="MRLSELSRRATAVVDHVEDREPADPISQRLRELGFVTGEEVRVVA
FT                   VGPFGGDPLVVQVGFTRFALRRQEAARVCVRAESATQPAAAIASPETAPPVKVREAA"
     MRLSELSRRA TAVVDHVEDR EPADPISQRL RELGFVTGEE VRVVAVGPFG GDPLVVQVGF        60
     TRFALRRQEA ARVCVRAESA TQPAAAIASP ETAPPVKVRE AA                          102
//

If you have problems or comments...

PBIL Back to PBIL home page