(data stored in SCRATCH zone)

EMBL: CP001069.PE180

CP001069.PE180       Location/Qualifiers
FT   CDS             complement(211233..212822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3951"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="KEGG: rso:RS03711 probable methyl-accepting
FT                   chemotaxis transducer transmembrane protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: histidine kinase HAMP region domain
FT                   protein; chemotaxis sensory transducer; PAS fold-3 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3951"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29056"
FT                   /db_xref="GOA:B2UHK5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK5"
FT                   /protein_id="ACD29056.1"
FT                   /translation="MRKNLPVTQAETALNPTDYLISRTDLKGLIVFANPAFVRISGYAH
FT                   DELMGAPHNLVRHPDMPEAAFADLWATLQAGKPWRGFVKNRRKDGGFYWVLANVTPVFQ
FT                   NNAVVGYTSVRSMAMPAQIARAQRAYTAINEGDTSYTVRAGRILRTGWRRVVNLFQIDS
FT                   LRFKVIGLQTLIASAILIGTVWAHIALEAADLHGAAWLVFSRDWLWLTGVGCAGLATMS
FT                   GVLLARTLIRPLEEAATLATRLAAGDLTTVVEARSSDELGEVMRAMGTMRASLSSIVRD
FT                   IQDGAASVAHSTQQISAGNHDLSARTEQQAAALEETASSMEELTSMVAQNADHARAASA
FT                   LAEQASTIAADGGQVVQRVVQTMDAIRADSQRVTEIIATIESIAFQTNILALNAAVEAA
FT                   RAGEEGRGFAVVAGEVRSLAQRSAQAAAQSKEIIRASDQSVRDGVDLVHKAGATMTQIV
FT                   QSVQTVTQLMSEISASSREQSSGIAQINASVSQLDGVTQQNATLVEEAAAATSVLARQS
FT                   EDLKHAIAVFRA"
     MRKNLPVTQA ETALNPTDYL ISRTDLKGLI VFANPAFVRI SGYAHDELMG APHNLVRHPD        60
     MPEAAFADLW ATLQAGKPWR GFVKNRRKDG GFYWVLANVT PVFQNNAVVG YTSVRSMAMP       120
     AQIARAQRAY TAINEGDTSY TVRAGRILRT GWRRVVNLFQ IDSLRFKVIG LQTLIASAIL       180
     IGTVWAHIAL EAADLHGAAW LVFSRDWLWL TGVGCAGLAT MSGVLLARTL IRPLEEAATL       240
     ATRLAAGDLT TVVEARSSDE LGEVMRAMGT MRASLSSIVR DIQDGAASVA HSTQQISAGN       300
     HDLSARTEQQ AAALEETASS MEELTSMVAQ NADHARAASA LAEQASTIAA DGGQVVQRVV       360
     QTMDAIRADS QRVTEIIATI ESIAFQTNIL ALNAAVEAAR AGEEGRGFAV VAGEVRSLAQ       420
     RSAQAAAQSK EIIRASDQSV RDGVDLVHKA GATMTQIVQS VQTVTQLMSE ISASSREQSS       480
     GIAQINASVS QLDGVTQQNA TLVEEAAAAT SVLARQSEDL KHAIAVFRA                   529
//

If you have problems or comments...

PBIL Back to PBIL home page