(data stored in SCRATCH zone)

EMBL: CP001069.PE183

CP001069.PE183       Location/Qualifiers
FT   CDS             complement(214232..214891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3954"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: rso:RS03708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3954"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29059"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK8"
FT                   /protein_id="ACD29059.1"
FT                   /translation="MRGWFGHHHKMWIEKHFMMGRHGHGGHGFGRGMGGPGGYGEGDDE
FT                   GGSPWRGRRLSSADLQLVLLALLKGTPRHGYELIKAVEEHSLGFYTPSPGMVYPALSYL
FT                   EDHGFASVTVEGNKKRYGITPEGETWLAERQHSADAILAQLRAMGERVKRMNEAMAFDR
FT                   ETDNAAEWTDTGHDPLRTARWRLKFALMEKRFASREEQQRVADILLRALKEITGER"
     MRGWFGHHHK MWIEKHFMMG RHGHGGHGFG RGMGGPGGYG EGDDEGGSPW RGRRLSSADL        60
     QLVLLALLKG TPRHGYELIK AVEEHSLGFY TPSPGMVYPA LSYLEDHGFA SVTVEGNKKR       120
     YGITPEGETW LAERQHSADA ILAQLRAMGE RVKRMNEAMA FDRETDNAAE WTDTGHDPLR       180
     TARWRLKFAL MEKRFASREE QQRVADILLR ALKEITGER                              219
//

If you have problems or comments...

PBIL Back to PBIL home page