(data stored in SCRATCH zone)

EMBL: CP001069.PE184

CP001069.PE184       Location/Qualifiers
FT   CDS             complement(215004..215519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3955"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: rme:Rmet_3441
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3955"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29060"
FT                   /db_xref="GOA:B2UHK9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK9"
FT                   /protein_id="ACD29060.1"
FT                   /translation="MSKRATAGKDNDTSRNAPSIPEPGQGKRGEEGYLGYLLRQASAAQ
FT                   RLRMERAMADVGVTLPQFLVLTMLRAYPGISNADLARLTMLTPQTVSVIVTNLERSGAI
FT                   TRRPHAVHGRIQHIDVTPEGSALLAACRKRSGGIEQDLLEGFTPEEEEVVRRWLVHVAK
FT                   LGSDKPAS"
     MSKRATAGKD NDTSRNAPSI PEPGQGKRGE EGYLGYLLRQ ASAAQRLRME RAMADVGVTL        60
     PQFLVLTMLR AYPGISNADL ARLTMLTPQT VSVIVTNLER SGAITRRPHA VHGRIQHIDV       120
     TPEGSALLAA CRKRSGGIEQ DLLEGFTPEE EEVVRRWLVH VAKLGSDKPA S                171
//

If you have problems or comments...

PBIL Back to PBIL home page