(data stored in ACNUC7421 zone)

EMBL: CP001069.PE187

CP001069.PE187       Location/Qualifiers
FT   CDS             216538..217164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3958"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: reu:Reut_A3273
FT                   (acyl-carrier protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3958"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29063"
FT                   /db_xref="GOA:B2UHL2"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL2"
FT                   /protein_id="ACD29063.1"
FT                   /translation="MTTLLHVTVSPRDDRSHSRRGAKWVVAQLAEAVGGLRVIERDLAA
FT                   TPLPHPDAGFVEASLTPDADRTAAHRAALALSETLIGELGAADAVLISTPVHNYTVPSA
FT                   LKAWIDLVVRPERTFRRTPTGKVGMLTDRSVLVVSASGGHFDGAHAQTDFLMPYLRYVF
FT                   ATVGIHQVEGIRLQNTARGADSAMQAFESFRQELAARMLLMPLVA"
     MTTLLHVTVS PRDDRSHSRR GAKWVVAQLA EAVGGLRVIE RDLAATPLPH PDAGFVEASL        60
     TPDADRTAAH RAALALSETL IGELGAADAV LISTPVHNYT VPSALKAWID LVVRPERTFR       120
     RTPTGKVGML TDRSVLVVSA SGGHFDGAHA QTDFLMPYLR YVFATVGIHQ VEGIRLQNTA       180
     RGADSAMQAF ESFRQELAAR MLLMPLVA                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page