(data stored in ACNUC7421 zone)

EMBL: CP001069.PE19

CP001069.PE19        Location/Qualifiers
FT   CDS             19004..20287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3779"
FT                   /product="putative proline-rich protein"
FT                   /note="KEGG: rso:RS02236 putative proline-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3779"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28895"
FT                   /db_xref="GOA:B2UH44"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH44"
FT                   /protein_id="ACD28895.1"
FT                   /translation="MFDPRPANAAPLPHHAASQADPQAFALERERVQAWLDARASGARA
FT                   VGASTLSQYRVEADRVCWYARTVGKPIAAWQREDALTYLRFLQDPPPWAISARGIDRSD
FT                   VNWTPLRGALSARSTRQCSIIAANLCGWLQRAGYLRANPFLDDDAIVITVPPPEAGTGT
FT                   ATEASIAGATPTQPQSRLSAADMGLIVDAVRARVALGREARLRQARDHFLAVLLAHASL
FT                   RVAELVAARMGDVALHAVPPADAAPDASLPASVWLLRAGSGRSQRWLPCDAIMGALREY
FT                   RTAFGLSPLPLPNEATPLLLSVRRRSPRRADGSIIDSPSLRRDFGERKGLASRSQLLLI
FT                   VKAMLSEAVDYARAMGQPDAAARLAHASLRGVRTAHLRERLAAGEAAADVARALGLAAL
FT                   PAVAVRAREADLAASIADAARKLATPSA"
     MFDPRPANAA PLPHHAASQA DPQAFALERE RVQAWLDARA SGARAVGAST LSQYRVEADR        60
     VCWYARTVGK PIAAWQREDA LTYLRFLQDP PPWAISARGI DRSDVNWTPL RGALSARSTR       120
     QCSIIAANLC GWLQRAGYLR ANPFLDDDAI VITVPPPEAG TGTATEASIA GATPTQPQSR       180
     LSAADMGLIV DAVRARVALG REARLRQARD HFLAVLLAHA SLRVAELVAA RMGDVALHAV       240
     PPADAAPDAS LPASVWLLRA GSGRSQRWLP CDAIMGALRE YRTAFGLSPL PLPNEATPLL       300
     LSVRRRSPRR ADGSIIDSPS LRRDFGERKG LASRSQLLLI VKAMLSEAVD YARAMGQPDA       360
     AARLAHASLR GVRTAHLRER LAAGEAAADV ARALGLAALP AVAVRAREAD LAASIADAAR       420
     KLATPSA                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page