(data stored in SCRATCH zone)

EMBL: CP001069.PE191

CP001069.PE191       Location/Qualifiers
FT   CDS             220251..221066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3962"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: pla:Plav_3016 beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3962"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29067"
FT                   /db_xref="GOA:B2UHL6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL6"
FT                   /protein_id="ACD29067.1"
FT                   /translation="MFSRWSKTFASALTACAVAMSTTTAHAELVVRNDLKRAFDDAGVS
FT                   GTFVLMDIGADRTYVVDPARAARRIHPASTFKIPNSLIAFDTGAVRDDQEVLPYGGKPQ
FT                   PYQQWEHDMALPEAIRLSAVPIYQEVARRVGLERMQAYVDAFEYGNRQLGSVIDQFWLR
FT                   GPLEISAFEEARFTSRMALKQLPVKPRTWDMVQRMLLIEQQGDAALYAKTGVATEYQPE
FT                   IGWWVGWVERAGHVYAFALNIDMPREGDMAKRVPLGKQLMQALAVWPAP"
     MFSRWSKTFA SALTACAVAM STTTAHAELV VRNDLKRAFD DAGVSGTFVL MDIGADRTYV        60
     VDPARAARRI HPASTFKIPN SLIAFDTGAV RDDQEVLPYG GKPQPYQQWE HDMALPEAIR       120
     LSAVPIYQEV ARRVGLERMQ AYVDAFEYGN RQLGSVIDQF WLRGPLEISA FEEARFTSRM       180
     ALKQLPVKPR TWDMVQRMLL IEQQGDAALY AKTGVATEYQ PEIGWWVGWV ERAGHVYAFA       240
     LNIDMPREGD MAKRVPLGKQ LMQALAVWPA P                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page