(data stored in ACNUC7421 zone)

EMBL: CP001069.PE192

CP001069.PE192       Location/Qualifiers
FT   CDS             221233..221676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3963"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3963"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29068"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL7"
FT                   /protein_id="ACD29068.1"
FT                   /translation="MFRVYKAMAVAITAAVGASGALAAGSQDGVIYFTGAIVEAGFRVL
FT                   PALQATGTGEGLQARRSASGDQVVLDFRSTAVRAVPVDVSVEARAASSLNPLRVGDARS
FT                   KADVLAKYGGFKANLLTANNGTLTLSRAPGVEPALAVVTLSYQ"
     MFRVYKAMAV AITAAVGASG ALAAGSQDGV IYFTGAIVEA GFRVLPALQA TGTGEGLQAR        60
     RSASGDQVVL DFRSTAVRAV PVDVSVEARA ASSLNPLRVG DARSKADVLA KYGGFKANLL       120
     TANNGTLTLS RAPGVEPALA VVTLSYQ                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page